Welcome to the Alhambra Civic Center Library Catalog!

2.50 Rating by CuteStat

This website is a sub-domain of alhambralibrary.org. It has a global traffic rank of #6395131 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, catalog.alhambralibrary.org is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 132
Daily Pageviews: 264

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 64
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 1,080
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 6,395,131
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

23.92.79.241

Hosted Country:

United States of America US

Location Latitude:

28.0109

Location Longitude:

-82.4948
Catalog — Alhambra Civic Center Library

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 11 H2 Headings: 2
H3 Headings: 2 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 40
Google Adsense: Not Applicable Google Analytics: Not Applicable

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx
Date: Wed, 08 Jan 2020 03:01:43 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Expires: Wed, 15 Oct 2008 20:28:45 GMT
Content-language: en
Strict-transport-security: max-age=31536000; includeSubDomains
Cache-Control: no-cache
Content-Script-Type: application/javascript
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
X-XSS-Protection: 1
Strict-Transport-Security: max-age=63072000; includeSubDomains; preload
Content-Security-Policy-Report-Only: default-src 'self' https://*.biblionix.com/; block-all-mixed-content; connect-src 'self' https://*.biblionix.com/ wss://localhost.biblionix.com:*/; font-src 'self' https://*.biblionix.com/ data:; img-src 'self' https://*.biblionix.com/ https://biblionix.com/hsts.png data:; media-src 'self' https://*.biblionix.com/ data:; script-src 'self' https://*.biblionix.com/ 'unsafe-eval' 'unsafe-inline' chrome:; style-src 'self' https://*.biblionix.com/ 'unsafe-inline'; report-uri https://www.biblionix.com/report/?block=0
Content-Encoding: gzip

DNS Record Analysis

Host Type TTL Extra
incero1-main.biblionix.com A 3533 IP: 23.92.79.241
catalog.alhambralibrary.org CNAME 7199 Target: alhambra.biblionix.com
incero1-main.biblionix.com AAAA 3600 IPV6: 2604:880:221:55:23:92:79:241

Similarly Ranked Websites

Home - Sanieattivi.it

- sanieattivi.it
6,395,134 $ 240.00

hattrick.de | Der Onlineshop für Sportartikel, Fußball Bekleidung, Fa

- hattrick.de

hattrick.de ★★★★★ Deutschlands Sport Shop ✔ Günstige Preise ✔ Schnelle Lieferung ✔ Große Auswahl ✔ Fußballschuhe und Sportbekleidung ✔ Alles für die hattrick Freunde ✔

6,395,139 $ 240.00

SMS Marketing | Group Text Reminders

- rockstarsmsmarketing.com

Statistics prove that nine out of every ten text messages are opened within one minute after they are received. This proves that text messages are rapidly

6,395,144 $ 8.95

ST Philips Hastings - Free Mp3 Downloads Songs Music

- stphilipshastings.com

ST Philips Hastings ✅ Free Mp3 music download ✅ Milions music audio mp3 songs and Audiobooks ✅ Price only $0 ✅ Listen music songs online ✅ Download Newest songs for FREE

6,395,151 $ 240.00

Adana Evden Eve Nakliyat ve Taşımacılık - 0322 270 00 70

- adanaevdenevenakliyatfirmalari.com

Adana evden eve nakliyat ve Adana evden eve taşımacılık firması olarak siz değerli müşterilerimize hizmet vermekten gurur duyarız. Sayısız referanslarımıza site üzerinden ulaşa bilirsiniz, dilerseniz iletişim bölümünden iletişime geçebilirsiniz.

6,395,157 $ 240.00